PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009622645.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 347aa    MW: 39646.3 Da    PI: 5.6767
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009622645.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.39.6e-201764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ede+l+d++k+ G  +W +I+++ g++R++k+c++rw++yl
   XP_009622645.1 17 KGPWTEDEDEKLIDYIKKNGHTNWQLIPKKAGLKRCGKSCRLRWNNYL 64
                     79*********************************************7 PP

2Myb_DNA-binding51.81.9e-1670115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ eE+e++++++  lG++ W++Ia++++ gRt++++k++++++l
   XP_009622645.1  70 RGGFSDEEEEIIINLHSVLGNK-WSRIANHLP-GRTDNEIKNFYNTHL 115
                      7889******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.5591268IPR017930Myb domain
SuperFamilySSF466891.05E-2914111IPR009057Homeodomain-like
SMARTSM007178.9E-171666IPR001005SANT/Myb domain
PfamPF002494.0E-181764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-251871IPR009057Homeodomain-like
CDDcd001679.86E-141964No hitNo description
SMARTSM007177.6E-1669117IPR001005SANT/Myb domain
PROSITE profilePS5129420.25769119IPR017930Myb domain
PfamPF002491.7E-1470115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2672119IPR009057Homeodomain-like
CDDcd001671.34E-1173114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGRYPCCKLD DDDDLKKGPW TEDEDEKLID YIKKNGHTNW QLIPKKAGLK RCGKSCRLRW  60
NNYLRPDIKR GGFSDEEEEI IINLHSVLGN KWSRIANHLP GRTDNEIKNF YNTHLKKKLL  120
KLGIDPKTHK PISDFDSLLK FSHQFTSTSN YFVSLASSLR LQAHFTLLAK IQQLLQSPLL  180
AINSNLFSSI QDNFLSNPNP PLFESLRYEG DQPQFLDSSL ANYITTIPCL DNTNSLPNYD  240
SSISNSSEVP SGVSDKIRTI QRRIASPSLY NDNMQKSRNG SNFSELCQAN ELNSNENQAE  300
GLAIRASNCN LNQNFIPTFS ELDDDMAAWE IPQDDEEINT FWNTIFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32141194108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622645.10.0PREDICTED: myb-related protein 315-like
TrEMBLM1BH832e-96M1BH83_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000451825e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-70myb domain protein 9